PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10022245m
Common NameCARUB_v10022245mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 226aa    MW: 25405.6 Da    PI: 4.8755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10022245mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285.1e-091045137
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                     +g+WT+eEd ll++++ ++G g W+ ++ + g +++ 
  Carubv10022245m 10 KGAWTAEEDALLKQCIDKYGEGKWHQVPLRAG-KLST 45
                     79**************************9999.6665 PP

2Myb_DNA-binding49.31.1e-154185248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+ +t+E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
  Carubv10022245m 41 GKLSTDEVDLLIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 85
                     5679*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-9539IPR009057Homeodomain-like
SuperFamilySSF466894.97E-18881IPR009057Homeodomain-like
SMARTSM007176.0E-15987IPR001005SANT/Myb domain
PROSITE profilePS5129420.4143589IPR017930Myb domain
PfamPF002494.7E-144185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-184385IPR009057Homeodomain-like
CDDcd001671.64E-114485No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEGSSKGLTK GAWTAEEDAL LKQCIDKYGE GKWHQVPLRA GKLSTDEVDL LIRLHKLLGN  60
RWSLIAGRLP GRTANDVKNY WNTHLSKKTE SCCKTKMRKK NIISHPTTTM VQKINVFKPR  120
PRSFTANNPF CSHLNGQPEV DVIPSSNGLN NNDVCENSIT FDKDDDDFIN NLIIEDNMWL  180
ENLLDEIQEP DAIVPEATTS EQGNTMAFDV ENLWSLFNGE TVELD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-128915110B-MYB
1h8a_C5e-1288925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301782.11e-168hypothetical protein CARUB_v10022245mg
SwissprotQ9ZTC31e-107MYB90_ARATH; Transcription factor MYB90
TrEMBLR0I9981e-168R0I998_9BRAS; Uncharacterized protein
STRINGscaffold_201358.11e-116(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66390.11e-108myb domain protein 90